Research Article - (2015) Volume 6, Issue 3
Induction of an appropriate immune response against gonadotrophin releasing hormone (GnRH-I) disrupt fertility, reduce fecundity and regress tumours of reproductive system.To disrupt fertility a plasmid DNA vaccine was engineered coding eight repeats of GnRH-I and eight T-helper epitopes. Translation efficiency of the vaccine was evaluated in undifferentiated COS1 cells and found to release GnRH-I fusion protein in culture supernatant. Swiss albino female mice (N=24) were immunized with 50μg plasmid DNA construct in study weeks 0, 3, 6, 9 and 12. Group 2 mice were primed with the plasmid DNA in hemagglutinating virus of japanese envelope (HVJE) vector and subsequent boosts were carried out in phosphate buffer saline. Group 3 mice were immunized with the plasmid DNA in non-ionic surfactant vesicles (NISV) and Group 1 was served as untreated control. The effect of immunization was studied in terms of anti-GnRH-I antibody response (OD value at A540 ± SD), suppression of ovarian folliculogenesis, altered uterine histoarchitecture and impaired fertility in vivo in mating trials. In study week 24 OD values of anti- GnRH-I antibody response were 0.982 ± 0.231 in Group 3 mice, followed by 0.783 ± 0.191 in Group 2 in comparison with no response in Group 1 controls (0.237 ± 0.147). Results of mating trials showed conception failure in vaccinated mice; 51, 18 and 05 pups were seen in the uteri of Groups 1, 2 and 3 mice respectively. There was significant (p>0.001) reduction in the weight of ovaries in Group 2 (8.50 ± 2.38 mg) and Group 3 (7.25 ± 0.95 mg) mice compared to Group 1 control (15.00 ± 1.41 mg). Significant reduction of ovarian folliculogenesis was seen in Group 2 (p>0.001) and Group 3 mice (p>0.01). In conclusion, the plasmid DNA vaccine delivered in female mice with HVJE and NISV induced significantly (p>0.001) higher levels of anti-GnRH-I antibody response, suppressed ovarian and uterine function and impaired fertility in vivo.
Keywords: Mice; DNA vaccine; GnRH-I; In vivo fertility; Ovarian folliculogenesis
It has now been over two decades since plasmid DNA vaccines were described as an inducer of effective immune response [1]. This type of vaccine has since been shown to hold promise for the treatment of cancer [2], allergies [3], prevention of infectious diseases [4], neutralization of fecundity of mammals [5,6] and suppression of fertility [7]. GnRH-I is the releaser of both luteinizing hormone (LH) and follicle stimulating hormone (FSH) and is a key peptide of reproduction [8]. GnRH-I immunoneutralization has, therefore, been used to neutralize fecundity of many domestic and wild mammals especially to prevent taint in meat (boars, lamb and muton), reduce sexual aggressiveness of farm animals [9,10] and to control feral animal populations [11]. Moreover, GnRH-I and its receptors are expressed in a number of malignant tumours of the breast, ovary, endometrium and prostate in mammals [12] and these have all contributed to a significant interest in neutralizing GnRH-I to control tumour growth [13,14].
Immunoneutralization of GnRH-I using GnRH-I peptide carrier conjugates is inefficiet in terms of variable chemical conjugation and heterogeneity of antigen preparations [14]. These problem can partially be obviated by using GnRH-I fusion proteins [9]. Both the antigens require adjuvants [6,9,15] to induce sufficient immunity and are not suitable for clinical application. One successful strategy to neutralize GnRH-I in mammals is the use of DNA vaccine [6,7,16]. However, DNA vaccines used in experimental trials are not equally efficient to induce robust antigen-specific immune response [3,17]. A number of methods have been used to enhance immunity of DNA vaccines including electroporation [18], use of non-viral [19] or synthetic vectors [20] and properties of encoded antigens [21]. Previously plasmid DNA vaccines were constructed coding four to five GnRH-I repeats [7,16] and following immunization the antibody response kinetics were slightly delayed. To overcome these disadvantages a new vaccine was constructed coding eight repeates of GnRH-I and the vaccine were delivered in a hemagglutinating virus of japanese envelope (HVJE) vector [19] and in a lipd based delivery system [20]. The level of GnRH-I immunoneutralisation was evaluated by means of anti-GnRH-I antibody responses, suppression of ovarian folliculogenesis and disruption of fertility in adult female mice.
Designing, engineering and amplifing of the vaccine
A plasmid DNA vaccine coding four repeats of GnRH-I [16] was digested with Xba1 enzyme and amplified with Tag A (5/- gcggccgctatctagaatgaagccaatt-3/) and Tag B (5/- ttctcgagctctagacgatgcacgatc-3/) oligonucleotides to develop Not1 and Xho1 cutting sites at 5/ and 3/ ends respectively. The end labeled oligonucleotides were than digested with Not1 and Xho1 enzymes and ligated into the upstream of the vaccine construct [7] at Not1 and Xho1 sites. The vaccine construct engineered incorporating GnRH-I leader sequences, eight repeats of GnRH-I interpersed with eight Thelper epitopes, an N terminal V5 epitope and a histidine tag before stop codon (Figure 1). The T-helper epitopes were derived from circumsporozoite protein (CSP), respiratory syncitial virus (RSV), measles virus protein (MVP) and tetanus toxoid (TT) [6]. Competence JM109 E. coli was transformed with the vaccine construct and amplified in LB medium containing ZeocinTM (40 μg/ml, Invitrogen Life technologies, USA). The plasmid DNA was extracted from the bulk culture of transformed E. coli using wizard plus Gigaprep kit (Promega, USA). A colony PCR was designed to amplify 981bp long fragment from the transformed E. coli using forward (5'- taatacgactcactataggg-3') and a reverse primers (5'acgatcacgcctttgatttc-3'). The complete GnRH-I and T-helper coding genes, the positions of the start and stop codons and the integrity of the open reading frames on to pcDNAV5-HisB plasmid were determined by sequence analysis.
Amino acid sequence of the vaccine: The blue letters indicate the sequences of the GnRH-I peptide and hhhhhh represents a histidine tag.
Mkpiqkllaglilltscvegcssqhwsyglrpggsgdiekkiakmekassvfnvvngklsge hwsyglrpgsgaeynvfhnktkelpraggehwsyglrpgggqyikanskfigitelgsgehwsy glrpggsglseikgvivhrlelesrmkpiqkllaglilltscvegcssqhwsyglrpggsgdiekkiak mekassvfnvvngklsgehwsyglrpgsgaeynvfhnktkelpraggehwsyglrpgggqyik anskfigitelgsgehwsyglrpggsglseikgvivhrlegprpegkpipnpllgldstrtghhhhh hstop
Relative position of GnRH-I and T-helper epitopes in the vaccine
Methionine-GnRH-I leader sequence-CSP-GnRH-I-RSV-GnRH-ITT- GnRH-I-Measles-GnRH-I leader sequence-CSP-GnRH-I-RSVGnRH- I-TT-GnRH-I-Measles-V5 epitope-Histidine tag-Termination
Expression of GnRH-I fusion protein
Previously engineered [7,16] and newly constructed plasmid DNA vaccines were used to evaluate and compare transformation efficiencies. The undifferentiated COS1 cells in 24 well cell culture plates were transfected with 2 μg plasmid DNA vaccines using Lipofectamine (Lipofectamine™ 2000, Life Technologies Inc. USA). Following 36 hours of transfection [16] the cell culture supernatant and the cell lysate were collected to detect GnRH-I fusion protein in Western blotting.
Western blotting detection of fusion protein
The fusion protein in the cell lysates and cell culture supernatant was electrophoresed on sodium dodecyl sulphate poly acrylamide gels for an hour [22]. A Kaleidoscope (Precision Plus Protein™ BIO-RAD) protein marker was included in the starting wells and the separated protein bands in the gels were transferred to a nitrocellulose membrane (HybondTMECL membrane, Amersham Bioscience). The GnRH-I fusion proteins [7,16] and newly designed on to the immunoblots were labelled with mouse monoclonal anti-GnRH-I antibody (Santa Cruz Biotechnology, USA) and anti-V5 antibody (Santa Cruz Biotechnology, USA). These antibodies were detected using Enhance Chemoluminoscence labeled anti-mouse IgG and X-ray imaging [23].
Entrapped vaccine construct
To entrap plasmid DNA vaccine, HVJE [19] and NISV [20] were used. The newly engineered plasmid DNA vaccine (50 μg/50 μl TE buffer) was entrapped in one agglutinating unit of HVJE vector (GenomONE-Neo Ex, Cosmo Bio Co., Ltd., Tokyo, Japan) and incubated on ice before priming of Group 2 mice. The NISV was prepared by using 136.4 mg 1-monopalmitoyl glycerol (Sigma-Aldrich, UK), 128.7 mg cholesterol (Sigma-Aldrich, UK) and 45.1 mg dicetyl phosphate(Sigma-Aldrich, UK) with a molar ratio of 5:4:1. 2.5 mg plasmid DNA vaccine was added in 5 ml lipid preparation and entrapped plasmid DNA by repeated snap freezing and thawing (60°C) for five cycles. Immediately before use, a tube containing 1.25 ml vaccine formulation in NISV was retrived from liquid nitrogen, a further 2 h shaking at 60°C was carried out and the solution was centrifuged at 450000 g for 45 min to form finest vesicles containing entrapped DNA. The tube was incubated on ice until immunization was carried out.
Immunization of mice
Five weeks old Swiss albino female mice (n=24) were obtained from the International Center for the Diarrheal Disease Research, Bangladesh and housed in the laboratory animal containment facility of Bangladesh Agricultural University, Mymensingh, Bangladesh. Pelleted feed and water were supplied at lib and was replenished twice daily. At the age of week seven, the mice were randomized, caged into groups of eight and ear coded. The mice were immunized with 50 μg plasmid DNA vaccine/mouse in study weeks 0, 3, 6, 9 and 12. Group 1 mice were immunized imtramuscularly with 50 μg naked plasmid DNA in 50 μl PBS and served as controls. Group 2 mice were primed with the plasmid DNA vaccine in HVJE and subsequent boostings in muscle (anterior quadriceps) were carried out in 50 μl PBS (pH 7.4). Group 3 mice were primed and boosted with 50 μg plasmid DNA vaccine in NISV through subcutenious (s.c) route. Out of eight mice in each group, four were used for breeding experiments and four were used to evaluate immune responses and histologic alteration of ovaries and uterus.
Host response of immunization
The body weight gain, feeding, oestrous behaviours, gait, morbidity and mortality pattern, weight of ovaries (in mg), gonadosomatal indices (GSI, mg of ovaries/100 gm body weight) [24] and histologic alteration of ovaries and uterus of the vaccinated and control mice were evaluated. In study week 26, vaginal cytology of mice was examined to detect phases of estrous [25]. In proestrous phase of estrous cycle (nucleated epithelial cells in vaginal cytology) the vaccinated and control mice were sacrificed by cervical dislocation, weight of ovaries were measured, ovaries and uteri were preserved in 10% (v/v) buffered neutral formalin and stained with Hematoxylin and Eosin (H&E) and Goldners trichome [7]. The number of ovarian follicles, healthy and regressing corpus luteum (CL) in ovaries and the number of uterine glands per uterine section using 10X and 100X microscopic objectives were recorded. The images were captured using an automated computer (Microimaging, Carl Zeiss, GmbH, Germany) connected to a microscope and ZEN lite 2012 software.
Measure anti GnRH-I antibody response
In study weeks 0, 3, 6, 12 and 24, 100 μl tail bleeds were carried out into heparinized capillary tubes (Selzer Labortechnik, Germany). Plasma was prepared by centrifugation at 200g for 10min and stored at -20°C until an indirect enzyme linked immunosorbant assay (ELISA) was carried out [16]. A base line OD value of 0.474 or above (twice the OD value of negative control) was considered a positive anti-GnRH-I antibody response.
Effect on in vivo fertility
In study week 24, the vaccinated female mice (four in each group) were mated individually with male mice. Control male and female mice were also mated individually to compare the differences. Following 10 days of mating (as the duration of estrous in vaccinated females lasts for 09-10 days, data was not shown) the male mice were withdrawn from the females. Following 16 days of mating the females were sacrificed by cervical dislocation and the number of pups in the uteri of each mouse were recorded.
Statistical analysis
Data between control and experimental groups were analyzed (Duncan’s Multiple Range Test) using the Statistical Package for Social Sciences version 17.0 (Chicago, IL, USA). A difference was considered significant at the p<0.05 level. Data were reported as the mean ± standard deviation (SD).
Results of sequence analysis revealed that the vaccine construct containing eight repeats of GnRH-I, eight T-helper epitopes, an N terminal V5 epitope and a histidine tag before stop codon (Figure 1). The GnRH-I fusion protein open reading frame onto the vaccine contained 981 nucleic acid bases and 326 amino acids.
Translation efficiencies of the vaccine
The plasmid DNA vaccines were efficiently translated their fusion proteins in COS1 cells. Results of Western blotting showed that the previous [7] and newly designed vaccine constructs released GnRH-I fusion proteins (18.871 kd and 35.216 kd respectively) in cell culture supernatant. GnRH-I fusion protein of a previous vaccine [16] was seen in transfected COS 1 cells (17.138 kd) but remained undetected in the cell culture supernatant (Figure 2).
Figure 2: Western blotting detection of GnRH-I fusion protein obtained from transfected COS 1 cells and labelled with anti- GnRH-I (left) and anti V5 antibodies (right). The first [10], second [6] and the new vaccines were used to transfect COS 1 cells. Lane 1 shows the Kaleidoscope ladder, lanes 2, 3 and 4 containing transfected COS1 cell lysate of the first, second and new vaccines respectively. Lanes 6, 7 and 8 containing transfected COS1 cell culture supernatant of the first, second and new vaccine repectively. Lane 5 and 9 containing non-transfected COS1 cell lysate and culture supernatant respectively (negative control) and lane 10 lacking both anti-GnRH-I (left) and anti V5 antibodies (right) in the Western blotting detection of the fusion protein. The newly engineered vaccine produce fusion protein (35.216 KD) detected both in cell lysate (lane 4) and cell culture supernatant (lane 8). GnRH-I fusion protein (17.138 KD) of the first vaccine (lane 2) was detected in the cell lysate (lane 6). GnRH-I fusion protein (18.871 KD) of the second vaccine was detected both in cell lysate (lane 3) and cell culture supernatant (lane 7). GnRH-I fusion protein was not detected in any of the control lane 5, 9 and 10.
Effect on growth and performance
Mice immunized with the vaccine in vectors did not develope any agitation during the study period. There was significant reduction in the weight of ovaries in Group 2 (8.50 ± 2.38mg, p>0.001) and Group 3 (7.25 ± 0.95mg, p>0.001) mice in contrast to 15.00±1.41mg in Group 1 control. The GSI was reduced to 16.33 ± 5.22 and 12.44 ± 2.02 in Group 2 and 3 mice, respectively in contrast to 32.28 ± 2.70 in Group 1 control (Table 1).
Groups of mice | Data represents were group average±SD | |||||||
---|---|---|---|---|---|---|---|---|
Effect on ovaries and GSI | Effect on ovarian follicles (number) | Effect on CL (number) | ||||||
Weight of ovaries | GSI | Premordial | Primary | Growing | Graffian | Healthy | Regressing | |
Group 1 | 15.00±1.41 | 208.00±4.320 | 20.5±4.2 | 5.25±1.71 | 6.5±2.65 | 4.5±2.081 | 4.5±1.92 | 6.25±1.26 |
Group 2 | 8.5±2.38 | 177.50±11.269 ٭ | 17.25±4.11 | 3.5±1.29 | 2.75±1.71 ٭٭ | 2.5±1.73 ٭٭ | 5.0±2.16 | 4.5±1.29 ٭ |
Group 3 | 7.2±0.957 | 130.50±25.775 ٭٭ | 18.25±2.22 | 4.25 | 4.5±1.0 ٭ | 2.25±0.5 ٭٭ | 4.25±0.96 | 4.75±1.71 ٭ |
Table 1: Level of oogenesis in vaccinated and control female mice as evaluated by the presence of different follicles and corpus luteum (CL) in theovary at terminal sacrifice. Each stained section was examined at low (10X) and high (40X, 100X) power microscopic field, and the number ofpremordial, primary, growing and graffian follicles, healthy CL and regressing CL were counted and compared with that of untreated controls.Significant difference (٭٭p>0.001, ٭p>0.01) in the count of growing follicles, graffian follicles and regressing CL were seen in Group 2 and Group3 mice compared to Group 1 control.
Detection of anti-GnRH-I antibodies
Results of indirect ELISA showed an early anti-GnRH-I IgG antibody response in Group 2 mice (0.451 ± 0.231) following three weeks of immunization. The anti GnRH-I antibody response in Group 3 mice (0.581 ± 0.273) was detected in study week 6. In study week 24 the anti-GnRH-I IgG antibody responses for Group 2 was 0.783 ± 0.191 and Group 3 was 0.982 ± 0.231, compared with 0.237 ± 0.147 for Group 1 (Figure 3).
Figure 3: Results of an indirect ELISA to detect anti GnRH-I antibody response in control (Group 1) and vaccinated (Group 2 and 3) female mice. Plasma anti GnRH-I antibody response was detected in Group 2 mice (0.451 ± 0.231) in study week 3. The anti GnRH-I antibody response in Group 3 mice (0.581 ± 0.273) was detected in study week 6. By the end of the study (week 24) the anti GnRH-I antibody response appeared higher in Group 3 (0.982 ± 0.231) mice followed by Group 2 (0.783 ± 0.191) mice in contrast to a lack of response in Group 1 control (0.237 ± 0.147).
Effect on ovarian folliculogenesis
Following immunization, the growth and development of growing follicles, graffian follicles, healthy and regressing CL per section of ovaries (Figure 4) were reduced. In study week 26 significant (p>0.01 to 0.001) reduction in the count of growing follicles, graffian follicles, healthy CL and regressing CL of ovaries was seen in Group 3 and Group 2 mice (Table 1) in contrast to the Group 1 controls.
Figure 4: Histological evaluation of the ovaries of Group 1 (a), Group 2 (b) and Group 3 (c) mice obtained at terminal sacrifice and stained with H&E (10X). There was significant (p>0.001) reduction in the count of graffian follicles (GF, 2.25 ± 0.5) in Group 2 mice. A reduction in the count of growing (2.75 ± 1.71) and graffian (2.5 ± 1.73) follicles in Group 3 mice (Table 1) was also seen as compared to growing (6.5 ± 2.65) and graffian follicles (4.5 ± 2.081) per section in Group 1 control (a) ovaries.
Effect on uterine architecture
Visible changes in the concentration of uterine glands in endometrium and thinness of myometrium were seen. In Group 1 mice the endometrium was enfolded in the lumen of the uterus (Figure 5). The endometrium of Group 2 and Group 3 mice were not folded in their lumen. While examining uterine section at 4X objective, the endometrium of Group 2 and Group 3 mice containing 8-15 uterine glands per section (Figure 5) compared with 40-50 uterine glands per sections in Group 1 control.
Figure 5: Histoarchitecture of uterine tissues of the control and vaccinated mice obtained at terminal sacrifice and stained with Goldners trichrome (4X). Immunization against GnRH-I found to reduce concentratoion of uterine glands (yellow). In an average 10-15 glands per uterine section in Group 2 (b) mice and 08-12 glands per section in Group 3 (c) mice was seen. The concentration of uterine glands (yellow arrow) appeared much higher in Group 1 (a, more than 40 glands per section) mice. The endometrium in control section (a) was repeatately folded in the lumen (black arrow) of uterus but were unfolded in Group 2 (b) and Group 3 (c) mice.
Effect on in vivo fertility
Results of in vivo fertility assay showed that half of the immunized mice (two in each group) were pregnant. All of the control mice appeared pregnant with 12-16 pups per mice. Two pregnant mice in Group 2 and Group 3 were found to have 18 and 05 pups in their uteri respectively.
Plasmid DNA vaccines are generally safe, non-toxic and have the potential to stimulate immune responses against hormones [6,7,16]. The low potency of plasmid DNA vaccines in large animals is that the injection of microgram doses of DNA results in the translation of only nanogram doses of protein [26] and most of the encoded proteins are not always released from the translation sites to the immune system [3]. Moreover, genetic immunization without a vector system is relatively inefficient [1,16] as most of the DNA is rapidly internalized and cleared by macrophages [27]. Repeated administration of plasmid DNA is, therefore, required to increase the duration and level of transgene expression [28]. Numerous factors have been identified that influence immune responses to DNA vaccines included the choice of vector [29], promoter strength [30], amount of DNA delivered [31], DNA formulation [32], location of expressed antigens whether secreted or cytosolic [33] and co-expression of co-stimulatory molecules [34].
Previously we engineered plasmid DNA vaccines coding four [16] to five [7] repeats of GnRH-I and four T helper epitopes and obtained anti GnRH-I antibody responses. To acheive relative higher immunity, this study engineered a plasmid DNA vaccine coding eight repeats of GnRH-I. Here the key focus was to incorporate more GnRH-I. The Thelper epitopes were incorporated in the vaccine to acheive a Th-2 response. A V5 epitope from the feline immunodeficiency virus was incorporated in the vaccine construct, enabling fusion protein to be released following transfection (Figure 2). A histidine tag was added from the pcDNAV5HisB plasmid to extract the fusion protein following transfection and immunoneutralization of native GnRH-I in mammals using fusion protein.
Effect on growth and performance
The mice tolerated well the plasmid DNA vaccine and there was insignificant difference in body weight gain by the end of this study. Group 3 mice developed little swelling at the injection sites and this was due to adjuvant effect of the vaccine [20]. Significance reduction in the weight of ovaries (Table 1) and GSI as seen in vaccinated mice was due to immunoneutralization of GnRH-I following vaccination [5,7].
Anti GnRH-I antibody response
Genetic immunization against GnRH-I found to generate IgG immune responses which were higher in Group 2 and Group 3 mice. The highest anti-GnRH-I IgG antibody response as seen in Group 3 mice was most likely due to adjuvant effect of NISV [20]. The earliest immune response was detected in Group 2 mice (Figure 3) and was due to delivery of plasmid DNA vaccine in HVJE. The HVJE vector system has been developed to introduce plasmid DNA into various organs in vivo [19]. However, repeated administration of plasmid DNA vaccine with the antigenic vector system is not recommended as the antibodies developed against vector following priming could have neutralized the vector during subsequent boosting [35,36], thus preventing transfection of cells or tissues with the DNA vaccine construct. The subsequent boosting in Group 2 mice was, therefore, carried out in PBS, but the level of anti-GnRH-I antibody response in study week 24 was below the response as seen in Group 3 mice. The use of other vector(s) or NISV during the subsequent boosting in HVJE mediated immunization could potentiate a Th-2 response, and requires further investigation.
Effect on in vivo fertility
Results of mating experiments revealed highest suppression of fertility in Group 3 mice, followed by Group 2 mice compared to Group 1 controls. Higher levels of anti-GnRH-I antibodies was detected in Group 2 and Group 3 mice and the number of pups in their uteri were low, a relationship between higher anti-GnRH-I antibody responses and suppressed in vivo fertility were co-rrelated. Level of folliculogenesis in the ovaries could have contributed to the fertility level of vaccinated mice as well.
Effect on ovarian folliculogenesis
The GnRH-I immunoneutralization studies showed suppression of ovarian folliculogenesis in vaccinated mice. There was significant reduction in the count of Graffian follicles in the ovaries of Group 2 (p>0.001) and Group 3 (p>0.01) mice (Table 1). Using H&E staining structural morphology of growing and Graffian follicles in ovaries were seen, but the morphology of premordial and primary follicles were indistinct. However, use of Goldner’s trichome staining the premordial and primary follicles were distinctly visible. The Goldners trichome staining enabled differentiation of healthy and regressing corpus luteum (CL) of ovaries by observing brick red color luteal cells of healthy CL and light pink color fibrosed body of regressing CL. The reduced in vivo fertility potential as seen in Group 2 and Group 3 mice could be due to suppression of folliculogenesis following GnRH-I immunoneutralization.
Effect on uterine histoarchitecture
Results of immunization showed its effect on to the densities of uterine glands in endometrium and thinness of uterine musculature (Figure 4). Highest level of anti GnRH-I antibody response was seen in Group 2 and Group 3 mice and highest reduction of uterine glands per section were seen in endometrium of Group 2 and Group 3 mice. Highest suppression of in vivo fertility was also seen in Group 2 and Group 3 mice. A state of endometrial inactivity as seen in vaccinated mice could have contributed to fertility suppression [37,38]. Bluish fibroid materials was seen in the uterine section of Group 2 and Group 3 mice and this could be due to uterine inertia or inactivity following GnRH-I immunoneutralization.
This study designed, engineered and evaluated a plasmid DNA vaccine aganist GnRH-I. The vaccine delivered in HVJE showed promising in terms of inducing an early immune response against GnRH-I, but in study week 24 the level of immune response appeared low because the subsequent boostings were carried out in PBS. The plasmid DNA vaccine delivered in NISV induced detectable levels of anti-GnRH-I antibody response in study week 6 and persistantly higher levels of IgG antibody were detected until study week 24. The vaccine delivered in HVJE and NISV induced higher levels of anti- GnRH-I antibody responses and suppressed ovarian folliculogenesis and impaired fertility in vivo. A link between the higher level of anti GnRH-I antibody response and suppressed fertility in mice was established. Priming of mice in HVJE vector and subseqent boosting in NISV could be a suitable approach for genetic immunization, that requires further investigation.
This work was supported by the Ministry of Science and Technology, Bangladesh. Thanks are due to Strathclyde Institute of Pharmacy and Biomedical Sciences, University of Strathclyde, Glasgow G4 ORE, UK for providing research and technical assistance. Part of this work was carried out in collaboration with the Department of Obstetrics and Gynecology, Osaka University Graduate School of Medicine, Osaka, Japan.